PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00576.1_g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 315aa    MW: 34935.1 Da    PI: 5.2698
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00576.1_g00020.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.2e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++l+ + +++G g W+t +++ g++R++k+c++rw +yl
  Rsa1.0_00576.1_g00020.1 14 KGAWTPEEDQKLIAYLQLHGEGGWRTLPEKAGLNRCGKSCRLRWANYL 61
                             79********************************************97 PP

2Myb_DNA-binding49.87.9e-1667111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg +T+ Ed+ +++++++ G++ W+tIa  ++ gRt++++k++w++ 
  Rsa1.0_00576.1_g00020.1  67 RGEFTPVEDDTIIKLHALKGNK-WATIATSLP-GRTDNEIKNYWNTN 111
                              899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.091965IPR017930Myb domain
SuperFamilySSF466891.8E-2911108IPR009057Homeodomain-like
SMARTSM007179.2E-141363IPR001005SANT/Myb domain
PfamPF002494.5E-161461IPR001005SANT/Myb domain
CDDcd001672.01E-101661No hitNo description
Gene3DG3DSA:1.10.10.605.3E-2565117IPR009057Homeodomain-like
SMARTSM007172.4E-1566114IPR001005SANT/Myb domain
PROSITE profilePS5129419.19266116IPR017930Myb domain
PfamPF002491.8E-1467112IPR001005SANT/Myb domain
CDDcd001674.83E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000162Biological Processtryptophan biosynthetic process
GO:0002213Biological Processdefense response to insect
GO:0009753Biological Processresponse to jasmonic acid
GO:0009759Biological Processindole glucosinolate biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MVRTPCCREE GIKKGAWTPE EDQKLIAYLQ LHGEGGWRTL PEKAGLNRCG KSCRLRWANY  60
LRPDIKRGEF TPVEDDTIIK LHALKGNKWA TIATSLPGRT DNEIKNYWNT NLKKRLKQKG  120
IDPSTHKPIN TTDQTDLEPK HHIGSSGSAR LLNRVASKYS VDSNRDILTG IIIGDSTNIA  180
DVSQNSGDVD SPTKKSTSTL LNKMAAASSA RTSILINNAS TSPGFSDNCS FTDDLTVFFS  240
NEEISDMYMH VDNVGFMEEL KGVLSYGVAD AGHIKDTPEV NVTDEMEFLD SWNEEDDLDL  300
EKFVSSLDSK VGVFV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26141167108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKRLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB7026950.0AB702695.1 Brassica oleracea var. viridis mRNA for Myb domain protein 34 (BoMyb34), complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009136410.10.0PREDICTED: transcription factor MYB34
RefseqXP_013670352.10.0PREDICTED: transcription factor MYB34-like
SwissprotO643991e-164MYB34_ARATH; Transcription factor MYB34
TrEMBLA0A078ERM30.0A0A078ERM3_BRANA; BnaA03g39790D protein
TrEMBLC5HYG60.0C5HYG6_BRARP; MYB domain protein 34-2
STRINGBra013000.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93311637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60890.11e-165myb domain protein 34